PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009733P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 287aa    MW: 30559.2 Da    PI: 6.8036
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009733P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.6e-3089142155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  MELO3C009733P1  89 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 142
                     59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.6E-2086146IPR009057Homeodomain-like
PROSITE profilePS5129411.05986145IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-3088147IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-2490142IPR006447Myb domain, plants
PfamPF002491.1E-792141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MKEDDSNWFS KWEQELPSPD ELMPLSQTLI TPDLALAFDI TNSNPLNDSH PPPPPPPPPV  60
IIQPSSADFA DSGDLGSGAG DEPARTLKRP RLVWTPQLHK RFVDAVAHLG IKNAVPKTIM  120
QLMSVDGLTR ENVASHLQKY RLYLKRMQGI SGGSGGGANG GAGLVSPASD PATDHLFASS  180
PVPPHFLHSA RGNSDHFLPF VPVGALQHHH HQMAAAAAAA QYHRQVAHFG SSPPTNGQFE  240
NTFLARPVHR VGAPVSTPVT NYSEDLDSGN GTGGRKVLTL FPTGND*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-2188147463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443222.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9LTH42e-45PCLL_ARATH; Transcription factor BOA
TrEMBLA0A0A0LC840.0A0A0A0LC84_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s03340.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.19e-78G2-like family protein